PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012574351.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 314aa    MW: 35706.1 Da    PI: 6.3425
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012574351.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.6e-191663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++lvd ++++G g+W++ +r  g++R++k+c++rw +yl
   XP_012574351.1 16 KGPWSPEEDKILVDHIQKHGHGSWRALPRLAGLNRCGKSCRLRWTNYL 63
                     79********************************************97 PP

2Myb_DNA-binding543.7e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E+ l+++++++lG++ W++Ia +++ gRt++++k++w+++l
   XP_012574351.1  69 RGNFSDQEENLIINLHALLGNK-WAAIATHLP-GRTDNEIKNFWNTHL 114
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-231166IPR009057Homeodomain-like
PROSITE profilePS5129417.0551163IPR017930Myb domain
SuperFamilySSF466896.36E-3113110IPR009057Homeodomain-like
SMARTSM007175.3E-151565IPR001005SANT/Myb domain
PfamPF002491.0E-161663IPR001005SANT/Myb domain
CDDcd001671.20E-111863No hitNo description
PROSITE profilePS5129426.57164118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2667119IPR009057Homeodomain-like
SMARTSM007171.8E-1668116IPR001005SANT/Myb domain
PfamPF002494.0E-1669114IPR001005SANT/Myb domain
CDDcd001673.82E-1271114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MMRTPISIND ENGLKKGPWS PEEDKILVDH IQKHGHGSWR ALPRLAGLNR CGKSCRLRWT  60
NYLRPDIRRG NFSDQEENLI INLHALLGNK WAAIATHLPG RTDNEIKNFW NTHLKKKLMQ  120
MGLDPVTHRP RTDHLDLLNN LQQIILNAAN IVTNCDINNN ALIRLQQLMT LSSNSSQSLI  180
NDVFGINNNN NTHSNNYLQN FYDGSNIGFS SSQIIEPNLQ NFEDPLQQLV PQACRYQEYL  240
NGDFTNVAAS TISSSLLPNL VSVSHRCDSP VKVEEDNMMK NAKECCSPSS TTLETWGDFM  300
NEDANDAYWK DFIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-281411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1267926e-97AC126792.15 Medicago truncatula clone mth2-8o8, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012574351.10.0PREDICTED: transcription factor MYB39-like
TrEMBLG7K5571e-162G7K557_MEDTR; Myb transcription factor
STRINGGLYMA01G44370.21e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.12e-79myb domain protein 107